General Information

  • ID:  hor001032
  • Uniprot ID:  F1LHM7
  • Protein name:  Neuropeptide PF1
  • Gene name:  NA
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SDPNFLRF
  • Length:  8(96-103)
  • Propeptide:  MMRQSHSVMSPYYVALFLIFCSSQVLGECCNDGQTSDFCAVFNMLSPTEQAEVRSYLGDNCDGDADEAVRKIEKRKPNFIRFGRTAPPLTFGKKGSDPNFLRFG
  • Signal peptide:  MMRQSHSVMSPYYVALFLIFCSSQVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Muscle relaxation
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F1LHM7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001032_AF2.pdbhor001032_ESM.pdb

Physical Information

Mass: 112013 Formula: C46H66N12O13
Absent amino acids: ACEGHIKMQTVWY Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -56.25 Boman Index: -2280
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 1403.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12613766
  • Title:  The effect of the anthelmintic emodepside at the neuromuscular junction of the parasitic nematode Ascaris suum